Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantDKK-1, Mouse

Dickkopf related protein 1 (DKK1) is a chemokine that belongs to the DKK protein family, which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. It is one of the most up-regulated genes during androgen-potentiated balding, with DKK-1 messenger RNA up-regulated a few hours after DHT treatment of hair follicles at the dermal papilla in vitro. Neutralizing bodies against DKK-1 reverses DHT effects on outer root sheath keratinocytes. DKK-1 expression is attenuated by L-threonate, a metabolite of ascorbate in vitro. DKK-1 promotes LRP6 internalization and degradation as it forms a ternary complex with the cell surface receptor Kremen. DKK-1 not only functions in head formation during development, but also regulates joint remodeling and bone formation indicating its potential role in the pathogenesis of rheumatoid arthritis and multiple myeloma.Recombinant Mouse Dickkopf-related protein 1 produced in CHO cells is a polypeptide chain containing 243 amino acids. A fully biologically active molecule, rmDKK-1 has a molecular mass of 19~20 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 6 µg/ml, measured in stimulation of alkaline phosphatase activity using CCl-226 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

19-20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse Dickkopf-related protein 1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse Dickkopf-related protein 1 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEE CGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPR GEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHF WSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQR H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurexin-2 Antibody
E55A15280 100 µg

Neurexin-2 Antibody

Sign In for Pricing
View Details
ZNF90 Antibody Blocking peptide
orb1454869 500 µg

ZNF90 Antibody Blocking peptide

Sign In for Pricing
View Details
Microspheres PS, S/DVB 6.00µm, PS06N
PS06003-1.0 1.0 g

Microspheres PS, S/DVB 6.00µm, PS06N

Sign In for Pricing
View Details
BPI Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-4292R-BF350 100 µL

BPI Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
NRXN3 Antibody
orb1265895 400 μl

NRXN3 Antibody

Sign In for Pricing
View Details
Anti-GRO alpha/CXCL1 Antibody Picoband®, HRP Conjugate
PA1760-HRP 100 µg/Vial

Anti-GRO alpha/CXCL1 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details