RecombinantDCIP-1/CXCL3, Mouse
Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as DCIP-1 (dendritic cell inflammatory protein-1) or MIP2b. CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of cerebellum, during morphogenesis. Recombinant mouse DCIP-1/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmDCIP-1/CXCL3 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Specifications
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
8 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog