Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantCT-1, Human

Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Human CT-1 is a 21.1 kDa protein consisting of 200 amino acid residues.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.4 ng/ml, measured in a cell proliferation assay using TF-1 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

24~26kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Cardiotrophin-1 (CT-1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Cardiotrophin-1 (CT-1) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGL PVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASA ASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RORA Protein Vector (Mouse) (pPM-C-HA)
PV225104 500 ng

RORA Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ARC (G-4) : m-IgGκ BP-HRP Bundle
sc-535971 1 Kit

ARC (G-4) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Anti-Phospho-PKM (Ser37) Polyclonal Antibody 2
TMAC-03351-01 50 μL

Anti-Phospho-PKM (Ser37) Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-Phospho-PKM (Ser37) Polyclonal Antibody 2
TMAC-03351-02 100 µL

Anti-Phospho-PKM (Ser37) Polyclonal Antibody 2

Sign In for Pricing
View Details
Phospho-PP2A alpha+beta (Tyr307) Rabbit Polyclonal Antibody (BF488)
orb2400753 100 µL

Phospho-PP2A alpha+beta (Tyr307) Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Lentiviral mouse Copa shRNA (UAS) - Lentiviral mouse Copa shRNA (UAS, iRFP) (25)
GTR15189458 1 Vial

Lentiviral mouse Copa shRNA (UAS) - Lentiviral mouse Copa shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details