Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantCT-1, Human

Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Human CT-1 is a 21.1 kDa protein consisting of 200 amino acid residues.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.4 ng/ml, measured in a cell proliferation assay using TF-1 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

24~26kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Cardiotrophin-1 (CT-1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Cardiotrophin-1 (CT-1) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGL PVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASA ASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-H discontinued
512032 100 µg

NF-H discontinued

Sign In for Pricing
View Details
Fgf15 3'UTR GFP Stable Cell Line
TU156534 1.0 mL

Fgf15 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Primary Neuronal Cell Medium
AFG-ELL-2423-01 100 mL

Primary Neuronal Cell Medium

Sign In for Pricing
View Details
Primary Neuronal Cell Medium
AFG-ELL-2423-02 500 mL

Primary Neuronal Cell Medium

Sign In for Pricing
View Details
Recombinant Human Chromodomain-helicase-DNA-binding protein 5 (CHD5) , partial
MBS1332200 Inquire

Recombinant Human Chromodomain-helicase-DNA-binding protein 5 (CHD5) , partial

Sign In for Pricing
View Details
Bovine Retinol Binding Protein 4 ELISA Kit
MBS737578-01 48 Well

Bovine Retinol Binding Protein 4 ELISA Kit

Sign In for Pricing
View Details