RecombinantBDNF, Human
BDNF, also known as brain-derived neurotrophic factor and abrineurin, is a neurotrophin belonging to the NGF-beta family. It is expressed highly in the brain, and moderately in the heart, lung, skeletal muscle and placenta. BDNF signals through its high affinity receptor gp145/trkB to exert neurotrophic properties. It has been shown to be involved in the survival and differentiation of both the central and peripheral nervous system. Specifically, BDNF regulates synaptic transmission, axonal growth and path-finding, as well as dendritic growth and morphology.
Product Specifications
CAS Number
9000-83-3
Endotoxin
<0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50<4μg/ml, measured in a bioassay using C6 cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
12-14kDa, observed by reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
TMIGD1 (Transmembrane and Immunoglobulin Domain-containing Protein 1, TMIGD, UNQ9372/PRO34164) (MaxLight 650)
TMIGD1 (Transmembrane and Immunoglobulin Domain-containing Protein 1, TMIGD, UNQ9372/PRO34164) (MaxLight 650)
Recombinant Sulfolobus tokodaii Membrane-associated ATPase C chain (atpP)
Recombinant Sulfolobus tokodaii Membrane-associated ATPase C chain (atpP)
