Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantBDNF, Human

BDNF, also known as brain-derived neurotrophic factor and abrineurin, is a neurotrophin belonging to the NGF-beta family. It is expressed highly in the brain, and moderately in the heart, lung, skeletal muscle and placenta. BDNF signals through its high affinity receptor gp145/trkB to exert neurotrophic properties. It has been shown to be involved in the survival and differentiation of both the central and peripheral nervous system. Specifically, BDNF regulates synaptic transmission, axonal growth and path-finding, as well as dendritic growth and morphology.

Product Specifications

CAS Number

9000-83-3

Endotoxin

<0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50<4μg/ml, measured in a bioassay using C6 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

12-14kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human BDNF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human BDNF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vitamin A (VA) ELISA Kit
YP-W21214-01 48 Tests

Mouse Vitamin A (VA) ELISA Kit

Sign In for Pricing
View Details
Mouse Vitamin A (VA) ELISA Kit
YP-W21214-02 96 Tests

Mouse Vitamin A (VA) ELISA Kit

Sign In for Pricing
View Details
SVOP Protein Vector (Human) (pPB-N-His)
PV040934 500 ng

SVOP Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
AZD4694 Precursor
orb1983176-01 5 mg

AZD4694 Precursor

Sign In for Pricing
View Details
AZD4694 Precursor
orb1983176-02 50 mg

AZD4694 Precursor

Sign In for Pricing
View Details
Anti-Human CD70 Antibody (27B3), APC
MBS1584048-01 50 Tests

Anti-Human CD70 Antibody (27B3), APC

Sign In for Pricing
View Details