Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human soluble CD40 Ligand (rHusCD40L)

CD40 ligand, CD40L (also known as CD154, TRAP or gp39), is a 261 amino acid type II transmembrane glycoprotein belonging to the TNF family, CD40L is expressed predominantly on activated CD4+ T lymphocytes, and also found in other types of cells, like NK cells, mast cells, basophils and eosinophils. Human CD40L shares 78% amino acid identity with its murine counterpart. The receptor of CD40L is CD40, a type I transmembrane glycoprotein belonging to the TNF receptor family. CD40 is expressed on B lymphocytes, monocytes, dendritic cells and thymic epithelium. Although all monomeric, dimeric and trimeric forms of soluble CD40L can bind to CD40, the trimeric form of soluble CD40L has the most potent biological activity through oligomerization of cell surface CD40, a common feature of TNF receptor family members. CD40L mediates a range of activities on B cells including induction of activation-associated surface antigen, entry into cell cycle, isotype switching and Ig secretion and memory generation. CD40-CD40L interaction also plays important roles in monocyte activation and dendritic cell maturation.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHusCD40L as determined by LAL method.

Purity

>95% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of IL-12 & IL-8 induction by PMB (Peripheral Mononuclear) cells was found to be <10 ng/ml, corresponding to a specific activity of > 1 x 106 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Approximately 16.3 kDa. a single non-glycosylated polypeptide chain containing 149 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.0.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNL VTLENGKQLT VKRQGLYYIY AQVTFCSNRE ASSQAPFIAS LWLKSPGRFE RILLRAANTH SSAKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

13,16-Docosadienamide
TRC-D784830-25MG 25 mg

13,16-Docosadienamide

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), CF647 conjugate, 0.1mg/mL
BNC471629-100 1x 100 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD22 Antibody
KC-12115-01 50 μL

CD22 Antibody

Sign In for Pricing
View Details
CD22 Antibody
KC-12115-02 100 µL

CD22 Antibody

Sign In for Pricing
View Details
CD22 Antibody
KC-12115-03 1 mL

CD22 Antibody

Sign In for Pricing
View Details
Histone H4 (Ab-12) Antibody
8D0033-AAT 50 µg

Histone H4 (Ab-12) Antibody

Sign In for Pricing
View Details