Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Migration Inhibitor Factor (rHuMIF)

Human MIF consists of two α-helices and six β-strands, four of which form a β-sheet. The two remaining β-strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory) . Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position 1. Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity. MIF has proinflammatory cytokine activity centered around aa’s 49 - 65. On fibroblasts, MIF induces, IL-1, IL-8 and MMP expression; on macrophages, MIF stimulates NO production and TNF-α release folllowing IFN-γ activation. MIF apparently acts through CD74 and CD44, likely in some form of trimeric interaction. Human MIF is active on mouse cells. Human MIF is 90%, 94%, 95%, and 90% aa identical to mouse, bovine, porcine and rat MIF, respectively.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuMIF as determined by LAL method.

Purity

>95% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active measured by its ability to bind rhCD74 in a functional ELISA.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Approximately 13.5 kDa, a single non-glycosylated polypeptide chain containing 123 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.

Host or Source

Escherichia coli

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GPR114 Antibody
A21409-50UG 50 µg

GPR114 Antibody

Ask
View Details
PRR20C Protein Lysate (Human) with C-Ha Tag
37794031 100 µg

PRR20C Protein Lysate (Human) with C-Ha Tag

Ask
View Details
Bovine Nuclear factor of activated T-cells, cytoplasmic 3 (NFATC3) ELISA Kit
EIA06859Bo 1 Kit

Bovine Nuclear factor of activated T-cells, cytoplasmic 3 (NFATC3) ELISA Kit

Ask
View Details
Mouse Vcl activation kit by CRISPRa
GA204587 1 Kit

Mouse Vcl activation kit by CRISPRa

Ask
View Details
IRAG1 (NM_001098579) Human Tagged ORF Clone
RG220170 10 µg

IRAG1 (NM_001098579) Human Tagged ORF Clone

Ask
View Details
NCI-H2073
ARC0604 1 Million

NCI-H2073

Ask
View Details