Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine Tumor Necrosis Factor-alpha (rMuTNF-α)

Tumor necrosis factor alpha (TNF-α) is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. Mouse TNF-α occurs as a membrane-anchored form. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. The biologically active native form of TNF-α is reportedly a trimer. Human and murine TNF-α show approximately 79% homology at the amino acid level and crossreactivity between the two species.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rMuTNF-α as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is < 0.1 ng/ml, corresponding to a specific activity of > 1x107 units/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Approximately 17.3 kDa. The recombinant murine TNF-alpha is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered solution in PBS, pH 7.2.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEKVNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRTAP20-3 activation kit by CRISPRa
GA117360 1 Kit

Human KRTAP20-3 activation kit by CRISPRa

Sign In for Pricing
View Details
CD6 (C6/372), CF488A conjugate, 0.1mg/mL
BNC880372-500 1x 500 µL

CD6 (C6/372), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DMEQ-TAD
TRC-D494400-25MG 25 mg

DMEQ-TAD

Sign In for Pricing
View Details
SLCO6A1 Human Gene Knockout Kit (CRISPR)
KN424129 1 Kit

SLCO6A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DAP12 (TYROBP) (NM_198125) Human Over-expression Lysate
LY403671 100 µg

DAP12 (TYROBP) (NM_198125) Human Over-expression Lysate

Sign In for Pricing
View Details
N-(Benzyloxycarbonyl)-L-glutamic Acid alpha-tert-Butyl Ester
TRC-B286245-1G 1 g

N-(Benzyloxycarbonyl)-L-glutamic Acid alpha-tert-Butyl Ester

Sign In for Pricing
View Details