Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine NOGGIN (rMuNOGGIN)

Noggin belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Noggin was originally identified as a BMP-4 antagonist whose action is critical for proper formation of the head and other dorsal structures. Consequently, Noggin has been shown to modulate the activities of other BMPs including BMP-2, -7, -13, and -14. Targeted deletion of Noggin in mice results in prenatal death and recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing Noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rMuNOGGIN as determined by LAL method.

Purity

>95% by SDS-PAGE and HPLC analyses.

Bioactivity

Determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC chondrogenic cells. The expected ED50 for this effect is 1.0-2.0 ng/ml of Noggin, corresponding to a Specific Activity of > 5 x 105 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Approximately 46.4 kDa disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSV PEGMVCKPSK SVHLTVLRWR CQRRGGQRCG WIPIQYPIIS ECKCSC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HERPUD2 Antibody
60-891 400 µL

HERPUD2 Antibody

Ask
View Details
ITM2A Polyclonal Antibody
RD87228A-01 60 μL

ITM2A Polyclonal Antibody

Ask
View Details
ITM2A Polyclonal Antibody
RD87228A-02 120 μL

ITM2A Polyclonal Antibody

Ask
View Details
ITM2A Polyclonal Antibody
RD87228A-03 200 µL

ITM2A Polyclonal Antibody

Ask
View Details
Cytokeratin 18 (KRT18) pSer33 Rabbit Polyclonal Antibody
AP02537PU-S 50 µL

Cytokeratin 18 (KRT18) pSer33 Rabbit Polyclonal Antibody

Ask
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) ESBP6 Polyclonal Antibody
MBS7160409 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) ESBP6 Polyclonal Antibody

Ask
View Details