Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pigment Epithelium-derived Factor (rHuPEDF)

PEDF is a noninhibitory serpin with neurotrophic, anti-angiogenic, and anti-tumorigenic properties. It is a 50 kDa glycoprotein produced and secreted in many tissues throughout the body. A major component of the anti-angiogenic action of PEDF is the induction of apoptosis in proliferating endothelial cells. In addition, PEDF is able to inhibit the activity of angiogenic factors such as VEGF and FGF-2. The neuroprotective effects of PEDF are achieved through suppression of neuronal apoptosis induced by peroxide, glutamate, or other neurotoxins. The recent identification of a lipase-linked cell membrane receptor for PEDF (PEDF-R) that binds to PEDF with high affinity should facilitate further elucidation of the underlying mechanisms of this pluripotent serpin. To date, PEDF-R is the only signaling receptor known to be used by a serpin family member. The unique range of PEDF activities implicate it as a potential therapeutic agent for the treatment of vasculature related neurodegenerative diseases such as age-related macular degeneration (AMD) and proliferative diabetic retinopathy (PDR) . PEDF also has the potential to be useful in the treatment of various angiogenesis-related diseases including a number of cancers.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuPEDF as determined by LAL method.

Purity

>95% by SDS-PAGE and HPLC analyses.

Bioactivity

Data Not Available.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Approximately 44.5 KDa, a single non-glycosylated polypeptide chain containing 400 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

MQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSMSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ABHD1 Antibody [DyLight 488]
NBP2-99171G 0.1 mL

Rabbit Polyclonal ABHD1 Antibody [DyLight 488]

Ask
View Details
Recombinant Human Phenylalanine--tRNA ligase alpha subunit (FARSA)
CSB-EP897084HU-01 20 µg

Recombinant Human Phenylalanine--tRNA ligase alpha subunit (FARSA)

Ask
View Details
Recombinant Human Phenylalanine--tRNA ligase alpha subunit (FARSA)
CSB-EP897084HU-02 100 µg

Recombinant Human Phenylalanine--tRNA ligase alpha subunit (FARSA)

Ask
View Details
Recombinant Human Phenylalanine--tRNA ligase alpha subunit (FARSA)
CSB-EP897084HU-03 1 mg

Recombinant Human Phenylalanine--tRNA ligase alpha subunit (FARSA)

Ask
View Details
BZW2 Antibody
E38QA3941 100 µL

BZW2 Antibody

Ask
View Details
Brilliant Violet 605™ anti-mouse CD20
GT05279 50 µg

Brilliant Violet 605™ anti-mouse CD20

Ask
View Details