Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Otoraplin (rHuOTOR)

OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3) -like domain. OTOR is predominantly expressed in the cochlea of the inner-ear and to a lesser extent in fetal brain and in some cartilage tissues. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/g of rHuOTOR as determined by LAL method.

Purity

Sterile Filtered White lyophilized (freeze-dried) powder.Data Not Available.

Bioactivity

Data Not Available.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

12.7 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.

Host or Source

Escherichia coli

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMG VVGYFPRNLV KEQRVYQEAT KEVPTTDIDF FCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-epsilon-Acp-OH
TRC-B285885-1G 1 g

Z-epsilon-Acp-OH

Sign In for Pricing
View Details
Dhh (NM_007857) Mouse Tagged ORF Clone Lentiviral Particle
MR227142L4V 200 µL

Dhh (NM_007857) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human/Mouse HMGB3 MAb (Clone 546737)
MAB5507 100 µg

Human/Mouse HMGB3 MAb (Clone 546737)

Sign In for Pricing
View Details
RN5S454 Recombinant Protein (Human)
RP088122 100 µg

RN5S454 Recombinant Protein (Human)

Sign In for Pricing
View Details
Nori® Monkey CD24 ELISA Kit
GR169283 96 Well

Nori® Monkey CD24 ELISA Kit

Sign In for Pricing
View Details
Fibroleukin
AP83555 1 mg

Fibroleukin

Sign In for Pricing
View Details