Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MIP-3 alpha (rHuMIP-3a/CCL20)

MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuMIP-3a/CCL20 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 10.0 -50.0 ng/ml, corresponding to a Specific Activity of > 2 x 104 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ZBTB40 Antibody [Alexa Fluor 488]
NBP2-81868AF488 0.1 mL

Rabbit Polyclonal ZBTB40 Antibody [Alexa Fluor 488]

Ask
View Details
pGAL1-BXI1(yeast)-HA-HIS3 Plasmid
PVT48471 2 µg

pGAL1-BXI1(yeast)-HA-HIS3 Plasmid

Ask
View Details
Ablim2 (NM_177678) Mouse Tagged ORF Clone Lentiviral Particle
MR223383L3V 200 µL

Ablim2 (NM_177678) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Wilforine discontinued
372071 5 mg

Wilforine discontinued

Ask
View Details
ACAT2 Antibody
A66612-100UL 100 µL

ACAT2 Antibody

Ask
View Details