Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MIG (rHuMIG/CXCL9)

CXCL9, a member of the α subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN-γ. CXCL9 has been shown to be a chemoattractant for activated T-lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy-terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has recently been cloned and shown to be highly expressed in IL-2-activated T-lymphocytes.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuMIG/CXCL9 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of > 1 x 104 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

11.7 kDa, a single non-glycosylated polypeptide chain containing 103 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Polyclonal TFEB Antibody
NB100-93447 0.1 mg

Goat Polyclonal TFEB Antibody

Ask
View Details
NGEF Antibody
A65038-100UL 100 µL

NGEF Antibody

Ask
View Details
Endochitinase Protein, Avena sativa, Recombinant (His)
MF-0102630-01 5 µg

Endochitinase Protein, Avena sativa, Recombinant (His)

Ask
View Details
Endochitinase Protein, Avena sativa, Recombinant (His)
MF-0102630-02 10 µg

Endochitinase Protein, Avena sativa, Recombinant (His)

Ask
View Details
Endochitinase Protein, Avena sativa, Recombinant (His)
MF-0102630-03 20 µg

Endochitinase Protein, Avena sativa, Recombinant (His)

Ask
View Details
Endochitinase Protein, Avena sativa, Recombinant (His)
MF-0102630-04 50 µg

Endochitinase Protein, Avena sativa, Recombinant (His)

Ask
View Details