Recombinant Human MCP-4 (rHuMCP-4/CCL13)
CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13.
Product Specifications
CAS Number
9000-83-3
Endotoxin
Less than 1EU/mg of rHuMCP-4/CCL13 as determined by LAL method.
Purity
>96% by SDS-PAGE and HPLC analyses.
Bioactivity
Reconstitution
Molecular Weight
8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Host or Source
Escherichia coli.
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
AA Sequence
QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
ADAM12 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Lipase, Pancreatic (PL) BioAssayTM ELISA Kit (Human)