Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphotactin (rHuLymphotactin/XCL1)

Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuCXCL13 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of > 1 x 104 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl.

Host or Source

Escherichia coli

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGOH Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV688954 1.0 µg DNA

MAGOH Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Lipin 3 (LPIN3) Mouse Monoclonal Antibody [Clone ID: LBI1D7]
AMM16726V 100 µL

Lipin 3 (LPIN3) Mouse Monoclonal Antibody [Clone ID: LBI1D7]

Sign In for Pricing
View Details
ZNF253 Polyclonal Antibody
E97598 100 µL

ZNF253 Polyclonal Antibody

Sign In for Pricing
View Details
PGBD1 Peptide (AAP39703)
AAP39703-100UG 100 µg

PGBD1 Peptide (AAP39703)

Sign In for Pricing
View Details
CKMT1A, 40-417aa, Human, His tag, E.coli
E53A01631 50 µg

CKMT1A, 40-417aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Tissue cDNA, First Strand, Human Diseased (Adult), Diabetes, Heart, BioGenomicsTM
T5595-0254G5 40 Tests

Tissue cDNA, First Strand, Human Diseased (Adult), Diabetes, Heart, BioGenomicsTM

Sign In for Pricing
View Details