Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphotactin (rHuLymphotactin/XCL1)

Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuCXCL13 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of > 1 x 104 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl.

Host or Source

Escherichia coli

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABRB2 Antibody (FITC)
orb354997-01 50 µg

GABRB2 Antibody (FITC)

Sign In for Pricing
View Details
GABRB2 Antibody (FITC)
orb354997-02 100 µg

GABRB2 Antibody (FITC)

Sign In for Pricing
View Details
Anti-CD20 Antibody Picoband® (monoclonal, 4D11), APC Conjugate
M03780-5-APC 100 µg/Vial

Anti-CD20 Antibody Picoband® (monoclonal, 4D11), APC Conjugate

Sign In for Pricing
View Details
LOC691931 3'UTR Luciferase Stable Cell Line
TU212449 1.0 mL

LOC691931 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 2B (WNT2B) ELISA Kit
RDR-WNT2B-Hu-48Tests 48 Tests

Human Wingless Type MMTV Integration Site Family, Member 2B (WNT2B) ELISA Kit

Sign In for Pricing
View Details
2310036O22Rik 3'UTR Luciferase Stable Cell Line
TU100432 1.0 mL

2310036O22Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details