Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IP-10 (rHuIP-10/CXCL10)

IP-10 was originally identified as an IFN-γ-inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1β, TNF-α, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of skin. The mouse homologue of human IP-10, Crg-2, has been cloned andshown to share approximately 67% amino acid sequence identity with human IP-10.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuIP-10/CXCL10 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of > 1 x 104 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

8.5 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DDX52 discontinued
388239 200 µL

DDX52 discontinued

Ask
View Details
HSPA13 siRNA (Mouse)
CRN1145-01 15 nmol

HSPA13 siRNA (Mouse)

Ask
View Details
HSPA13 siRNA (Mouse)
CRN1145-02 30 nmol

HSPA13 siRNA (Mouse)

Ask
View Details
Recombinant Human IL-20
1102-IL-025 25 µg

Recombinant Human IL-20

Ask
View Details
Recombinant Macaca fascicularis Claudin (CLDN18)-VLPs (Active)
MBS9019715-01 0.02 mg (Mammalian-Cell)

Recombinant Macaca fascicularis Claudin (CLDN18)-VLPs (Active)

Ask
View Details
Recombinant Macaca fascicularis Claudin (CLDN18)-VLPs (Active)
MBS9019715-02 0.1 mg (Mammalian-Cell)

Recombinant Macaca fascicularis Claudin (CLDN18)-VLPs (Active)

Ask
View Details