Recombinant Human IP-10 (rHuIP-10/CXCL10)
IP-10 was originally identified as an IFN-γ-inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1β, TNF-α, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of skin. The mouse homologue of human IP-10, Crg-2, has been cloned andshown to share approximately 67% amino acid sequence identity with human IP-10.
Product Specifications
CAS Number
9000-83-3
Endotoxin
Less than 1EU/mg of rHuIP-10/CXCL10 as determined by LAL method.
Purity
>97% by SDS-PAGE and HPLC analyses.
Bioactivity
Reconstitution
Molecular Weight
8.5 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Host or Source
Escherichia coli.
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
AA Sequence
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items