Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HCC-4 (rHu HCC-4/CCL16)

Human HCC-4, also named NCC-4, liver-expressed chemokine (LEC), and lymphocyte and monocyte chemoattractant (LMC), is a novel CC chemokine identified through bioinformatics. HCC-4 cDNA encodes a 120 amino acid (aa) residue precursor protein with a 23 aa residue predicted signal peptide that is cleaved to generate a 97 aa residue mature protein. HCC-4 is distantly related to other CC chemokines, exhibiting less than 30% sequence identity. Among these CC chemokines, HCC-4 has the most similarity to HCC-1. Two potential polyadenylation signals are present on the human HCC-4 gene, and as a result, two transcripts containing approximately 1,500 base pairs and 500 base pairs have been detected. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is highly upregulated in the presence of IL-10.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuHCC-4/CCL16 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract total human monocytes using a concentration range of 10.0 -100.0 ng/ml, corresponding to a Specific Activity of > 1 x 104 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

11.2 kDa, a single non-glycosylated polypeptide chain containing 97 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydrazine Acetate
TRC-H685000-50G 50 g

Hydrazine Acetate

Sign In for Pricing
View Details
DLK2 Rabbit Polyclonal Antibody
TA367648 100 µL

DLK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MID1IP1 (NM_021242) Human Over-expression Lysate
LC429650 20 µg

MID1IP1 (NM_021242) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Amino-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione
TRC-A295840-250MG 250 mg

5-Amino-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione

Sign In for Pricing
View Details
Olfr9 Rabbit Polyclonal Antibody
TA363583 100 µL

Olfr9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 19 Recombinant Mouse Monoclonal Antibody [A3D1-R]
HA601258 100 µL

Cytokeratin 19 Recombinant Mouse Monoclonal Antibody [A3D1-R]

Sign In for Pricing
View Details