Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ENA-78 (5-78a.a.) (rHuENA-78 (CXCL5) )

Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuENA-78/CXCL5 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 5.0-10.0 ng/ml, corresponding to a Specific Activity of > 1 x 105 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sall4 Lentiviral Activation Particles (h2)
sc-401033-LAC-2 200 µL

Sall4 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
ARHGEF3 Antibody
MBS9406670-01 0.05 mL

ARHGEF3 Antibody

Sign In for Pricing
View Details
ARHGEF3 Antibody
MBS9406670-02 0.1 mL

ARHGEF3 Antibody

Sign In for Pricing
View Details
ARHGEF3 Antibody
MBS9406670-03 5x 0.1 mL

ARHGEF3 Antibody

Sign In for Pricing
View Details
LOC139272 Human qPCR Primer Pair (XM_066606)
HP220923 200 Reactions

LOC139272 Human qPCR Primer Pair (XM_066606)

Sign In for Pricing
View Details
PCR Strip Cap Tool
KGQ-08 1 PC

PCR Strip Cap Tool

Sign In for Pricing
View Details