Recombinant Human ENA-78 (5-78a.a.) (rHuENA-78 (CXCL5) )
Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays.
Product Specifications
CAS Number
9000-83-3
Endotoxin
Less than 1EU/mg of rHuENA-78/CXCL5 as determined by LAL method.
Purity
>97% by SDS-PAGE and HPLC analyses.
Bioactivity
Reconstitution
Molecular Weight
8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Host or Source
Escherichia coli.
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
AA Sequence
AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Available Sizes
Explore Other Products
Browse additional items from our catalog