Recombinant Human BCA-1 (rHuBCA-1/CXCL13)
CXCL13, also known as B-lymphocyte chemoattractant (BLC), is a CXC chemokine that is constitutively expressed in secondary lymphoid organs. BCA-1 cDNA encodes a protein of 109 amino acid residues with a leader sequence of 22 residues. Mature human BCA-1 shares 64% amino acid sequence similarity with the mouse protein and 23 - 34% amino acid sequence identity with other known CXC chemokines. Recombinant or chemically synthesized BCA-1 is a potent chemoattractant for B lymphocytes but not T lymphocytes, monocytes or neutrophils. BLR1, a G protein-coupled receptor originally isolated from Burkitt’s lymphoma cells, has now been shown to be the specific receptor for BCA-1. Among cells of the hematopoietic lineages, the expression of BLR1, now designated CXCR5, is restricted to B lymphocytes and a subpopulation of T helper memory cells. Mice lacking BLR1 have been shown to lack inguinal lymph nodes. These mice were also found to have impaired development of Peyer’s patches and defective formation of primary follicles and germinal centers in the spleen as a result of the inability of B lymphocytes to migrate into B cell areas
Product Specifications
CAS Number
9000-83-3
Endotoxin
Less than 1EU/g of rHuBCA-1/CXCL13 as determined by LAL method.
Purity
>97% by SDS-PAGE and HPLC analyses.
Bioactivity
Reconstitution
Molecular Weight
10.3 kDa, a single non-glycosylated polypeptide chain containing 87 amino acids.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Host or Source
Escherichia coli.
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
AA Sequence
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items