Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhesus macaque SAA1 (rRhSAA1)

Serum amyloid A proteins (SAA) represents a family of apolipoproteins that circulates in association with high-density lipoproteins (HDL) . The level of apo-SAA, normally 1-5 μg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL apo-lipoprotein.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/g of rRhSAA1 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/ml, corresponding to a Specific Activity of > 1 x 105 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Approximately 11.8 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGG VWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Olfactory receptor 5K4 (OR5K4) ELISA Kit
MBS7210748-01 48 Well

Mouse Olfactory receptor 5K4 (OR5K4) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 5K4 (OR5K4) ELISA Kit
MBS7210748-02 96 Well

Mouse Olfactory receptor 5K4 (OR5K4) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 5K4 (OR5K4) ELISA Kit
MBS7210748-03 5x 96 Well

Mouse Olfactory receptor 5K4 (OR5K4) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 5K4 (OR5K4) ELISA Kit
MBS7210748-04 10x 96 Well

Mouse Olfactory receptor 5K4 (OR5K4) ELISA Kit

Sign In for Pricing
View Details
Diphtheria Toxoid (Frozen)
NAT41609-1000 1 Each

Diphtheria Toxoid (Frozen)

Sign In for Pricing
View Details
Human OR52N1 shRNA Plasmid
abx962390-01 150 µg

Human OR52N1 shRNA Plasmid

Sign In for Pricing
View Details