Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine Vascular Endothelial Growth Factor 165 (rMuVEGF165)

VEGF was initially purified from media conditioned by normal bovine pituitary folliculo-stellate cells and by a variety of transformed cell lines as a mitogen specific for vascular endothelial cells. It was subsequently found to be identical to an independently discovered vascular permeability factor (VPF), which was previously identified in media conditioned by tumor cell lines based on its ability to increase the permeability of capillary blood vessels. Three mouse cDNA clones, which arise through alternative splicing and which encode mature mouse monomeric VEGF having 120, 164, or 188, amino acids, respectively, have been identified. Two receptor tyrosine kinases (RTKs), Flt-1 and Flk-1 (the mouse homologue of human KDR), both members of the type III subclass of RTKs containing seven immunoglobulin-like repeats in their extracellular domains, have been shown to bind VEGF with high affinity. The roles of the homodimers of KDR, Flt, and the heterodimer ofKDR/Flt in VEGF signal transduction remain to be elucidated.In vivo, VEGF has been found to be a potent angiogenesis inducer.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rmVEGF165 as determined by LAL method

Purity

>95% by SDS-PAGE and HPLC analyses

Bioactivity

Measured by its ability to stimulate 3H-thymidine incorporation in HUVE cells. The ED50 for this effect is typically 2 - 4 ng/mL, corresponding to a Specific Activity of > 2.5 x 105 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Recombinant murine VEGF165 is a 39.0 kDa disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 532 goat anti-rabbit IgG (H+L)
16616-AAT 200 µg

IFluor® 532 goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
POMZP3 (NM_012230) Human Over-expression Lysate
LY402170 100 µg

POMZP3 (NM_012230) Human Over-expression Lysate

Sign In for Pricing
View Details
Tixocortol 21-Pivalate
TRC-T447500-10MG 10 mg

Tixocortol 21-Pivalate

Sign In for Pricing
View Details
CACNB1 (C-term) Rabbit Polyclonal Antibody
AP50704PU-N 400 µL

CACNB1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TGIF (TGIF1) (NM_173211) Human Over-expression Lysate
LY430398 100 µg

TGIF (TGIF1) (NM_173211) Human Over-expression Lysate

Sign In for Pricing
View Details
4-[(2-Chloroethyl)amino]-L-phenylalanine Dihydrochloride
TRC-C363800-5MG 5 mg

4-[(2-Chloroethyl)amino]-L-phenylalanine Dihydrochloride

Sign In for Pricing
View Details