Recombinant Human Neurotrophin-4 (rHuNT-4)
Neurotrophin-4 (NT-4), also known as NT-5, is a member of the NGF family of neuronal and epithelial growth factors. Neurotrophins have six conserved cysteine residues that are involved in the formation of three disulfide bonds. Human NT-4 shares 48 - 52% aa sequence identity with human beta-NGF, BDNF, and NT-3. It shares 91% and 95% aa sequence identity with mouse and rat NT-4/5, respectively. The mature protein is secreted as a homodimer and can also form heterodimers with BDNF or NT-3. NT-4 binds and induces receptor dimerization and activation of TrkB. NT-4 promotes the development and survival of selected peripheral and CNS neurons. NT-4 induced TrkB signaling augments NMDA receptor activity and increases neuronal sensitivity to excitotoxic cell death. It also promotes the proliferation of keratinocytes and accelerates hair follicle regression during the follicular cycle. NT-4 is secreted by activated T cells and granulocytes at sites of inflammation where it contributes to tissue regeneration.
Product Specifications
CAS Number
9000-83-3
Endotoxin
Less than 1EU/g of rHuNT-4 as determined by LAL method.
Purity
>97% by SDS-PAGE and HPLC analyses.
Bioactivity
Reconstitution
Molecular Weight
28 kDa, a noncovalently linked homodimer of two 14.0 kDa polypeptide monomers (260 total amino acid residues) .
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Host or Source
Escherichia coli.
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
AA Sequence
GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACV CTLLSRTGRA
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog