Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurotrophin-4 (rHuNT-4)

Neurotrophin-4 (NT-4), also known as NT-5, is a member of the NGF family of neuronal and epithelial growth factors. Neurotrophins have six conserved cysteine residues that are involved in the formation of three disulfide bonds. Human NT-4 shares 48 - 52% aa sequence identity with human beta-NGF, BDNF, and NT-3. It shares 91% and 95% aa sequence identity with mouse and rat NT-4/5, respectively. The mature protein is secreted as a homodimer and can also form heterodimers with BDNF or NT-3. NT-4 binds and induces receptor dimerization and activation of TrkB. NT-4 promotes the development and survival of selected peripheral and CNS neurons. NT-4 induced TrkB signaling augments NMDA receptor activity and increases neuronal sensitivity to excitotoxic cell death. It also promotes the proliferation of keratinocytes and accelerates hair follicle regression during the follicular cycle. NT-4 is secreted by activated T cells and granulocytes at sites of inflammation where it contributes to tissue regeneration.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/g of rHuNT-4 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures was found to be in the range of 20-50 ng/ml, corresponding to a Specific Activity of > 2 x 104 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

28 kDa, a noncovalently linked homodimer of two 14.0 kDa polypeptide monomers (260 total amino acid residues) .

Storage Conditions

This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACV CTLLSRTGRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Involucrin (IVRN/827), CF488A conjugate, 0.1mg/mL
BNC880827-100 1x 100 µL

Involucrin (IVRN/827), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Albumin (ALB) (NM_000477) Human Recombinant Protein
TP305943M 100 µg

Albumin (ALB) (NM_000477) Human Recombinant Protein

Sign In for Pricing
View Details
Lithocholic Acid 24-Ac-O-beta-D-Glucuronide
TRC-L469195-2MG 2 mg

Lithocholic Acid 24-Ac-O-beta-D-Glucuronide

Sign In for Pricing
View Details
Recombinant Human MGAT5/GGNT5 Protein (His Tag)
PKSH030446 50 µg

Recombinant Human MGAT5/GGNT5 Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS801637 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
TWF2 (NM_007284) Human Over-expression Lysate
LC402125 20 µg

TWF2 (NM_007284) Human Over-expression Lysate

Sign In for Pricing
View Details