Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MIP-4 (rHuMIP-4/CCL18)

CCL18, is a novel CC chemokine that is highly homologous to MIP-1α (61% amino acid sequence identity) . CCL18 cDNA encodes an 89 aa residue precursor protein with a 20 aa putative signal peptide that is cleaved to generate a 69 aa residue mature protein which lacks potential glycosylation sites. In vitro, CCL18 mRNA expression is induced in alternatively activated macrophages by Th2 cytokines such as IL-4, IL-10 and IL-13, and inhibited by IFN-γ. CCL18 mRNA is also expressed by GM-CSF/IL-4-induced monocyte-derived dendritic cells. In vivo, CCL18 is highly expressed in lung and placenta but is not expressed in epidermal Langerhans cells. Recombinant CCL18 has been shown to chemoattract naive T cells, but not monocytes or neutrophils.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuMIP-4/CCL18 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 1.0 -10.0 ng/ml, corresponding to a Specific Activity of > 1 x 105 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.

Host or Source

Escherichia coli

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAST205 (MAST2) Mouse Monoclonal Antibody [Clone ID: OTI7B7]
CF808834 100 µg

MAST205 (MAST2) Mouse Monoclonal Antibody [Clone ID: OTI7B7]

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF740 conjugate, 0.1mg/mL
BNC742670-100 1x 100 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tide Fluor™ 2, succinimidyl ester [TF2 SE]*Superior replacement for fluorescein*
2248-AAT 5 mg

Tide Fluor™ 2, succinimidyl ester [TF2 SE]*Superior replacement for fluorescein*

Sign In for Pricing
View Details
MATR3 Polyclonal Antibody
E-AB-11382-01 20 µL

MATR3 Polyclonal Antibody

Sign In for Pricing
View Details
MATR3 Polyclonal Antibody
E-AB-11382-02 60 µL

MATR3 Polyclonal Antibody

Sign In for Pricing
View Details
MATR3 Polyclonal Antibody
E-AB-11382-03 120 µL

MATR3 Polyclonal Antibody

Sign In for Pricing
View Details