Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MCP-2 (rHu MCP-2/CCL8)

MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the CC family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1.MCP-3 also shares 58% amino acid identity with MCP-2. Similarly to other CC chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuMCP-2/CCL8 as determined by LAL method.

Purity

>96% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50 for this effect is typically 0.03-0.1μg/mL, corresponding to a Specific Activity of > 1 x 104 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BORIS (F-1) PE
sc-377085 PE 200 µg/mL

BORIS (F-1) PE

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized RING finger protein P32A8.03c (SPAP32A8.03c), partial
MBS1475106 Inquire

Recombinant Schizosaccharomyces pombe Uncharacterized RING finger protein P32A8.03c (SPAP32A8.03c), partial

Sign In for Pricing
View Details
C20orf202 (NM_001009612) Human Over-expression Lysate
LS400831-20ug 20 µg

C20orf202 (NM_001009612) Human Over-expression Lysate

Sign In for Pricing
View Details
anti-PRRT2
YF-PA21813 50 ug

anti-PRRT2

Sign In for Pricing
View Details
Meox1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4878302 1.0 µg DNA

Meox1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
LNCaP C-51
ARC0453 1 Million

LNCaP C-51

Sign In for Pricing
View Details