Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Keratinocye Growth Factor-1 (rHuKGF-1)

Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30 - 50% sequence identity at the amino acid level. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of variety of tissues, by promoting cellular proliferation and differentiation. KGF-1/FG-7 is a mitogen factor specific for epithelial cells and keratinocytes and signals through FGFR 2b. KGF-1/FGF-7 plays a role in kidney and lung development, angiogenesis, and wound healing.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuKGF-1 as determined by LAL method.

Purity

>96% by SDS-PAGE and HPLC analyses.

Bioactivity

The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 <10ng/ml, corresponding to a specific activity of ≥ 1 x 105 units/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Approximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids.

Storage Conditions

This lyophilized preparation is stable for several weeks at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered solution in 20mM PB, pH 8.0, 1M NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQK GIPVRGKKTK KEQKTAHFLP MAIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LT-alpha (C-term) Rabbit Polyclonal Antibody
0807-6 100 µL

LT-alpha (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAN1A1 Antibody
KC-32773-01 50 μL

MAN1A1 Antibody

Sign In for Pricing
View Details
MAN1A1 Antibody
KC-32773-02 100 µL

MAN1A1 Antibody

Sign In for Pricing
View Details
MAN1A1 Antibody
KC-32773-03 1 mL

MAN1A1 Antibody

Sign In for Pricing
View Details
ROC2 (RNF7) (NM_014245) Human Over-expression Lysate
LC402297 20 µg

ROC2 (RNF7) (NM_014245) Human Over-expression Lysate

Sign In for Pricing
View Details
PE Anti-Human CD9 Antibody[HI9a]
E-AB-F1086D-01 20 Tests

PE Anti-Human CD9 Antibody[HI9a]

Sign In for Pricing
View Details