Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GRO-beta (rHuGRO-beta/ CXCL2)

The three GRO cDNAs encode 107 amino acid precursor proteins from which the N-terminal 34 amino acid residues are cleaved to generate the mature GROs. There are no potential N-linked glycosylation sites in the amino acid sequences. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.Similar to other alpha chemokines, the three GRO proteins are potent neutrophil attractants and activators. In addition, these chemokines are also active toward basophils. All three GROs can bind with high affinity to the IL-8 receptor type B.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHuGRO-beta/CXCL2 as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. Determined by its ability to chemoattract hCXCR2 transfected 293 cells using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of > 1 x 104 IU/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

7.9 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse cluster Of differentiation, CD34 ELISA Kit
MBS164064-01 48 Well

Mouse cluster Of differentiation, CD34 ELISA Kit

Sign In for Pricing
View Details
Mouse cluster Of differentiation, CD34 ELISA Kit
MBS164064-02 96 Well

Mouse cluster Of differentiation, CD34 ELISA Kit

Sign In for Pricing
View Details
Mouse cluster Of differentiation, CD34 ELISA Kit
MBS164064-03 5x 96 Well

Mouse cluster Of differentiation, CD34 ELISA Kit

Sign In for Pricing
View Details
Mouse cluster Of differentiation, CD34 ELISA Kit
MBS164064-04 10x 96 Well

Mouse cluster Of differentiation, CD34 ELISA Kit

Sign In for Pricing
View Details
HPV16 E6 + HPV18 E6 Rabbit Polyclonal Antibody (APC)
orb995241 100 µL

HPV16 E6 + HPV18 E6 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
mmu-miR-202-3p miRNA Inhibitor
MIM01462 2x 5.0 nmol

mmu-miR-202-3p miRNA Inhibitor

Sign In for Pricing
View Details