Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glia Maturation Factor beta (rHuGMF-β)

GMF-β, a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family. GMF-β appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/g of rHuGMF-b as determined by LAL method.

Purity

>98% by SDS-PAGE and HPLC analyses.

Bioactivity

Data Not Available.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Approximately 16.5 KDa, a single non-glycosylated polypeptide chain containing 141 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNT EDLTEEWLREKLGFFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5C Rabbit Polyclonal Antibody (FITC)
orb2117985 100 µL

UNC5C Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Anti-Lamin B2 Antibody
MBS8324240-01 0.03 mL

Anti-Lamin B2 Antibody

Sign In for Pricing
View Details
Anti-Lamin B2 Antibody
MBS8324240-02 0.05 mL

Anti-Lamin B2 Antibody

Sign In for Pricing
View Details
Anti-Lamin B2 Antibody
MBS8324240-03 0.1 mL

Anti-Lamin B2 Antibody

Sign In for Pricing
View Details
Anti-Lamin B2 Antibody
MBS8324240-04 0.2 mL

Anti-Lamin B2 Antibody

Sign In for Pricing
View Details
Anti-Lamin B2 Antibody
MBS8324240-05 5x 0.2 mL

Anti-Lamin B2 Antibody

Sign In for Pricing
View Details