Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain Natriuretic Peptide (rHuBNP)

Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/g of rHuCNTF as determined by LAL method.

Purity

>97% by SDS-PAGE and HPLC analyses.

Bioactivity

Data Not Available.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB3 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 3, NADH-Ubiquinone Oxidoreductase B12 Subunit, Complex I-B12, CI-B12) (HRP)
130224-HRP 100 µL

NDUFB3 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 3, NADH-Ubiquinone Oxidoreductase B12 Subunit, Complex I-B12, CI-B12) (HRP)

Sign In for Pricing
View Details
Recombinant Human Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (MAN1A1)
orb2902095-01 20 µg

Recombinant Human Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (MAN1A1)

Sign In for Pricing
View Details
Recombinant Human Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (MAN1A1)
orb2902095-02 100 µg

Recombinant Human Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (MAN1A1)

Sign In for Pricing
View Details
Recombinant Human HBB, N-His
MBS1574357-01 0.1 mg

Recombinant Human HBB, N-His

Sign In for Pricing
View Details
Recombinant Human HBB, N-His
MBS1574357-02 1 mg

Recombinant Human HBB, N-His

Sign In for Pricing
View Details
Recombinant Human HBB, N-His
MBS1574357-03 5x 1 mg

Recombinant Human HBB, N-His

Sign In for Pricing
View Details