Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine Fibroblast Growth Factor-basic (rMubFGF)

FGF basic (FGF-2, HBGF-2) is one of at least 22 mitogenic proteins of the FGF family, which show 35 - 60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted. Transcription from alternate start sites produces 21 - 24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH-3T3 cells.

Product Specifications

Endotoxin

Less than 1EU/mg of rMubFGF as determined by LAL method.

Purity

>98% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. The ED50, as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is <0.1ng/ml, corresponding to a specific activity of of > 1x107 units/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Approximately 16.2 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

CAS Number

9000-83-3

AA Sequence

MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lrrc23-set siRNA/shRNA/RNAi Lentivector (Rat)
27631096 4 x 500 ng

Lrrc23-set siRNA/shRNA/RNAi Lentivector (Rat)

Ask
View Details
Rabbit Polyclonal BID Antibody [DyLight 405]
NB500-245V 0.1 mL

Rabbit Polyclonal BID Antibody [DyLight 405]

Ask
View Details
NKX3.1 Antibody
47-139 0.1 mg

NKX3.1 Antibody

Ask
View Details
IAV H3N2 (aa 18-530) (A/Aichi/2/1968) [His]
DAG1694 50 ug

IAV H3N2 (aa 18-530) (A/Aichi/2/1968) [His]

Ask
View Details