Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor- acidic (rHuaFGF)

FGF acidic, also known as FGF-1 and endothelial cell growth factor, is a member of the FGF family of mitogenic peptides which currently is comprised of at least seven proteins which show 35-55% amino acid sequence conservation. FGF acidic and basic, unlike the other members of the family, lack signal peptides and are apparently secreted by mechanisms other than the classical protein secretion pathway. FGF acidic has been detected in large amounts in the brain. Other cells known to express FGF acidic include hepatocytes, vascular smooth muscle cells, CNS neurons, skeletal muscle cells, fibroblasts, keratinocytes, endothelial cells, intestinal columnar epithelium cells and pituitary basophils and acidophils. As with other FGF’s, FGF acidic exhibits considerable species crossreactivity. FGF acidic and FGF basic stimulate the proliferation of all cells of mesodermal origin, and many cells of neuroectodermal, ectodermal and endodermal origin.

Product Specifications

CAS Number

9000-83-3

Endotoxin

Less than 1EU/mg of rHu aFGF as determined by LAL method.

Purity

>95% by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. The ED50, calculated by the dose-dependant proliferation of BAF3 cells expressing FGF receptors (measured by 3H-thymidine uptake) is less than 10 ng/ml, corresponding to a specific activity of ≥ 1x105 units/mg.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Molecular Weight

Approximately 15.8 kDa, a single non-glycosylated polypeptide chain containing 140 amino acids.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.

Host or Source

Escherichia coli.

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

AA Sequence

MFNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ttc21b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
48670116 3x 1.0 µg

Ttc21b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Ask
View Details
4-(Pyrrolidin-3-yl)piperazine-1-carboxylic Acid tert-Butyl Ester-d8
TRC-P998517-100MG 100 mg

4-(Pyrrolidin-3-yl)piperazine-1-carboxylic Acid tert-Butyl Ester-d8

Ask
View Details
Human FLT3- Y726F Ba/F3 Stable Cell Line
T3687 1x106 cells / 1.0 mL

Human FLT3- Y726F Ba/F3 Stable Cell Line

Ask
View Details
Mouse Monoclonal IPO-38 Antibody (IPO-38)
NBP2-45194-0.1mg 0.1 mg

Mouse Monoclonal IPO-38 Antibody (IPO-38)

Ask
View Details
Human Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4 ELISA Kit
MBS721226-01 48 Well

Human Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4 ELISA Kit

Ask
View Details
Human Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4 ELISA Kit
MBS721226-02 96 Well

Human Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4 ELISA Kit

Ask
View Details