Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Mouse (110a.a)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Mouse is produced by E.coli (M130-R239), with tag free.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Mouse (110a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-mouse-110a-a.html

Purity

98.0

Smiles

MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR

Molecular Formula

18049 (Gene_ID) P01139 (M130-R239) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[2]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[3]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[4]Yada M, et al. NGF stimulates differentiation of osteoblastic MC3T3-E1 cells. Biochem Biophys Res Commun. 1994 Dec 15;205 (2) :1187-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 750 Anti-human CD45 Antibody *HI185*
104530L0-AAT 100 Tests

IFluor® 750 Anti-human CD45 Antibody *HI185*

Sign In for Pricing
View Details
Frizzled 10/CD350 Rabbit Polyclonal Antibody (Cy3)
orb986554 100 µL

Frizzled 10/CD350 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
WIPF1 siRNA (Human)
MBS8223239-01 15 nmol

WIPF1 siRNA (Human)

Sign In for Pricing
View Details
WIPF1 siRNA (Human)
MBS8223239-02 30 nmol

WIPF1 siRNA (Human)

Sign In for Pricing
View Details
WIPF1 siRNA (Human)
MBS8223239-03 5x 30 nmol

WIPF1 siRNA (Human)

Sign In for Pricing
View Details
ZNF302-set siRNA/shRNA/RNAi Lentivector (Human)
51430091 4x 500 ng

ZNF302-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details