Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRZB, Human (HEK293, His)

FRZB protein is a soluble Frizzled-related protein (sFRP) that modulates Wnt signaling by directly interacting with Wnt, thereby regulating cell growth and differentiation. FRZB, also known as SFRP3, plays a key role in limb skeletogenesis as a Wnt8 signaling antagonist. FRZB Protein, Human (HEK293, His) is the recombinant human-derived FRZB protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FRZB Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frzb-protein-human-hek293-his.html

Purity

96.00

Smiles

AAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN

Molecular Formula

2487 (Gene_ID) Q92765/NP_001454.2 (A32-N325) (Accession)

Molecular Weight

Approximately 41 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ECT2 Antibody [Biotin]
NBP1-28729B 0.1 mL

Rabbit Polyclonal ECT2 Antibody [Biotin]

Sign In for Pricing
View Details
Probable cation-transporting ATPase 13A3 (ATP13A3) Human ELISA Kit
G1038 96 Tests

Probable cation-transporting ATPase 13A3 (ATP13A3) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Human AIM2 Protein, N-His
orb2969986-01 50 µg

Recombinant Human AIM2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human AIM2 Protein, N-His
orb2969986-02 100 µg

Recombinant Human AIM2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human AIM2 Protein, N-His
orb2969986-03 1 mg

Recombinant Human AIM2 Protein, N-His

Sign In for Pricing
View Details
COQ2 Recombinant Protein (Mouse)
RP125534 100 µg

COQ2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details