Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Double homeobox protein 4 (DUX4), partial

Product Specifications

Product Name Alternative

Double homeobox protein 10

Abbreviation

Recombinant Human DUX4 protein, partial

Gene Name

DUX4

UniProt

Q9UBX2

Expression Region

327-424aa

Organism

Homo sapiens (Human)

Target Sequence

AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Stem Cells

Relevance

Transcription factor that is selectively and transiently expressed in cleavage-stage embryos. Binds to double-stranded DNA elements with the consensus sequence 5'-TAATCTAATCA-3'. Binds to chromatin containing histone H3 acetylated at 'Lys-27' (H3K27ac) and promotes deacetylation of H3K27ac. In parallel, binds to chromatin that lacks histone H3 acetylation at 'Lys-27' (H3K27ac) and recruits EP300 and CREBBP to promote acetylation of histone H3 at 'Lys-27' at new sites. Involved in transcriptional regulation of numerous genes, primarily as transcriptional activator, but mediates also repression of a set of target genes. Promotes expression of ZSCAN4 and KDM4E, two proteins with essential roles during early embryogenesis. Heterologous expression in cultured embryonic stem cells mediates also transcription of HERVL retrotransposons and transcripts derived from ACRO1 and HSATII satellite repeats. May activate expression of PITX1. May regulate microRNA (miRNA) expression. Inappropriate expression can inhibit myogenesis and promote apoptosis. ; [Isoform 2]: Probably inactive as a transcriptional activator, due to the absence of the C-terminal region that is important for transcriptional activation. Can inhibit transcriptional activation mediated by isoform 1. Heterologous expression of isoform 2 has no deleterious effect on cell survival.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12936411/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mmu-miR-1258-5p agomir
HY-R02646A-01 5 nmol

Mmu-miR-1258-5p agomir

Ask
View Details
Mmu-miR-1258-5p agomir
HY-R02646A-02 20 nmol

Mmu-miR-1258-5p agomir

Ask
View Details
Recombinant Protein Tyrosine Phosphatase, Non Receptor Type 13 (PTPN13)
RPD593Mu01-01 10 µg

Recombinant Protein Tyrosine Phosphatase, Non Receptor Type 13 (PTPN13)

Ask
View Details
Recombinant Protein Tyrosine Phosphatase, Non Receptor Type 13 (PTPN13)
RPD593Mu01-02 50 µg

Recombinant Protein Tyrosine Phosphatase, Non Receptor Type 13 (PTPN13)

Ask
View Details
Recombinant Protein Tyrosine Phosphatase, Non Receptor Type 13 (PTPN13)
RPD593Mu01-03 100 µg

Recombinant Protein Tyrosine Phosphatase, Non Receptor Type 13 (PTPN13)

Ask
View Details
Recombinant Protein Tyrosine Phosphatase, Non Receptor Type 13 (PTPN13)
RPD593Mu01-04 200 µg

Recombinant Protein Tyrosine Phosphatase, Non Receptor Type 13 (PTPN13)

Ask
View Details