Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adiponectin receptor protein 1 (ADIPOR1), partial

Product Specifications

Product Name Alternative

Adiponectin receptor protein 1 (Progestin and adipoQ receptor family member 1) (Progestin and adipoQ receptor family member I)

Abbreviation

Recombinant Human ADIPOR1 protein, partial

Gene Name

ADIPOR1

UniProt

Q96A54

Expression Region

89-375aa

Organism

Homo sapiens (Human)

Target Sequence

EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Tag

Tag-Free

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Cardiovascular

Relevance

Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism (PubMed:25855295, PubMed:12802337) . Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.0 kDa

References & Citations

"PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif." Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J.M., Emtage P.C., Funk W.D. J. Mol. Evol. 61:372-380 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PITX2, CT (Pituitary Homeobox 2, Paired-like Homeodomain Transcription Factor 2, Homeobox Protein PITX2, RIEG Bicoid-related Homeobox Transcription Factor, Solurshin, ALL1-responsive Protein ARP1, PITX2, ARP1, RGS, RIEG, RIEG1) (MaxLight 550) discontinued
P9182-98A-ML550 100 µL

PITX2, CT (Pituitary Homeobox 2, Paired-like Homeodomain Transcription Factor 2, Homeobox Protein PITX2, RIEG Bicoid-related Homeobox Transcription Factor, Solurshin, ALL1-responsive Protein ARP1, PITX2, ARP1, RGS, RIEG, RIEG1) (MaxLight 550) discontinued

Ask
View Details
MARCKS (myristoylated alanine-Rich Protein Kinase C Substrate, 80K-L, FLJ14368, FLJ90045, MACS, PKCSL, PRKCSL) (MaxLight 650)
MBS6228665-01 0.1 mL

MARCKS (myristoylated alanine-Rich Protein Kinase C Substrate, 80K-L, FLJ14368, FLJ90045, MACS, PKCSL, PRKCSL) (MaxLight 650)

Ask
View Details
MARCKS (myristoylated alanine-Rich Protein Kinase C Substrate, 80K-L, FLJ14368, FLJ90045, MACS, PKCSL, PRKCSL) (MaxLight 650)
MBS6228665-02 5x 0.1 mL

MARCKS (myristoylated alanine-Rich Protein Kinase C Substrate, 80K-L, FLJ14368, FLJ90045, MACS, PKCSL, PRKCSL) (MaxLight 650)

Ask
View Details
50ml Tube Foam Rack
VT-H7 1 Each

50ml Tube Foam Rack

Ask
View Details
Magnet kit
1070240 1 Each

Magnet kit

Ask
View Details
Recombinant Mouse IL-17A (CHO-expressed) CF
7956-mL-025/CF 25 µg

Recombinant Mouse IL-17A (CHO-expressed) CF

Ask
View Details