Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICOS, Rat (HEK293, Fc)

ICOS is a key protein for T cell function and can significantly enhance various T cell responses to foreign antigens. It plays a crucial role in promoting T cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promoting efficient secretion of B cell antibodies. ICOS Protein, Rat (HEK293, Fc) is the recombinant rat-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

ICOS Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/icos-protein-rat-hek293-fc.html

Purity

95.60

Smiles

ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKL

Molecular Formula

64545 (Gene_ID) Q9R1T7-1 (E21-L142) (Accession)

Molecular Weight

Approximately 43-50 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S) -3- (p-Methylphenyl) -beta-alanine
OR1045967-01 100 mg

(S) -3- (p-Methylphenyl) -beta-alanine

Sign In for Pricing
View Details
(S) -3- (p-Methylphenyl) -beta-alanine
OR1045967-02 250 mg

(S) -3- (p-Methylphenyl) -beta-alanine

Sign In for Pricing
View Details
(S) -3- (p-Methylphenyl) -beta-alanine
OR1045967-03 1 g

(S) -3- (p-Methylphenyl) -beta-alanine

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Recombinant Lotus japonicus Putative membrane protein ycf1 (ycf1), partial
MBS7097870 Inquire

Recombinant Lotus japonicus Putative membrane protein ycf1 (ycf1), partial

Sign In for Pricing
View Details