Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF12A, Human (HEK293, Fc)

TNFRSF12A Protein, the receptor for TNFSF12/TWEAK, acts as a weak apoptosis inducer in specific cell types. It also promotes angiogenesis, endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins. Association with TRAF1, TRAF2, and potentially TRAF3 underscores its involvement in diverse cellular signaling pathways. TNFRSF12A Protein, Human (HEK293, Fc) is the recombinant human-derived TNFRSF12A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TNFRSF12A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf12a-protein-human-hek-293-fc.html

Purity

95.0

Smiles

EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW

Molecular Formula

51330 (Gene_ID) Q9NP84-1 (E28-W79) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMPR1B Rabbit Polyclonal Antibody
E53P06737 100 µL

BMPR1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-[2-(Dipropylamino)ethyl]-6-nitrophenyl Acetic Acid Hydrochloride
MBS6064050-01 100 mg

2-[2-(Dipropylamino)ethyl]-6-nitrophenyl Acetic Acid Hydrochloride

Sign In for Pricing
View Details
2-[2-(Dipropylamino)ethyl]-6-nitrophenyl Acetic Acid Hydrochloride
MBS6064050-02 5x 100 mg

2-[2-(Dipropylamino)ethyl]-6-nitrophenyl Acetic Acid Hydrochloride

Sign In for Pricing
View Details
Rabbit Monoclonal CIRBP Antibody (3V9S7)
NBP3-15745-100ul 100 µL

Rabbit Monoclonal CIRBP Antibody (3V9S7)

Sign In for Pricing
View Details
RNU4-1B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
67016111 3x 1.0 µg

RNU4-1B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
2,2'- (2,5-Dimethoxy-1,4-Phenylene) Bis (4,4,5,5-Tetramethyl-1,3,2-Dioxaborolane)
OR1009903-01 100 mg

2,2'- (2,5-Dimethoxy-1,4-Phenylene) Bis (4,4,5,5-Tetramethyl-1,3,2-Dioxaborolane)

Sign In for Pricing
View Details