Question 1

What is the catalog number for Human C7 (Complement Component 7) ELISA Kit?

Accepted Answer

The catalog number for Human C7 (Complement Component 7) ELISA Kit is RE1450H.

Question 2

What sizes are available for Human C7 (Complement Component 7) ELISA Kit?

Accepted Answer

Human C7 (Complement Component 7) ELISA Kit is available in the following size(s): 48 Tests, 96 Tests.

Question 3

How many pack sizes does Human C7 (Complement Component 7) ELISA Kit come in?

Accepted Answer

Human C7 (Complement Component 7) ELISA Kit is available in 2 different pack sizes.

Question 4

Is Human C7 (Complement Component 7) ELISA Kit in stock?

Accepted Answer

Human C7 (Complement Component 7) ELISA Kit is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

Can I return this product if I ordered the wrong one?

Accepted Answer

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Question 6

Is this product tested for endotoxin levels?

Accepted Answer

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Question 7

Can I request additional validation data, such as western blot images, for this product?

Accepted Answer

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

Human C7 (Complement Component 7) ELISA Kit

Product Specifications

CAS Number

Product Name Alternative

Species Reactivity

Field of Research

Detection Method

Assay Performance Time

Sample Type

Detection Range

Sensitivity

Species

Available Sizes

Documents

Frequently Asked Questions

Explore Other Products

Anti-MoonTag (Recombinant Alpaca, Monoclonal, VHH-His)

H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

RFPL3 Antibody

RFPL3 Antibody