Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESM-1, Mouse (HEK293, His)

ESM-1 (Endocan) serves a vital role in angiogenesis by promoting new blood vessel sprouting. Its implication in lung endothelial cell-leukocyte interactions suggests potential significance in regulating immune responses within the pulmonary vasculature. ESM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ESM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ESM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/esm-1-protein-mouse-hek-293-his.html

Purity

95.50

Smiles

WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR

Molecular Formula

71690 (Gene_ID) Q9QYY7 (W20-R184) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS4 (NM_033028) Human Recombinant Protein
TP306210 20 µg

BBS4 (NM_033028) Human Recombinant Protein

Sign In for Pricing
View Details
DIRAS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10A6]
TA809401BM 100 µL

DIRAS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10A6]

Sign In for Pricing
View Details
PML Antibody
KC-2353-01 50 μL

PML Antibody

Sign In for Pricing
View Details
PML Antibody
KC-2353-02 100 µL

PML Antibody

Sign In for Pricing
View Details
PML Antibody
KC-2353-03 1 mL

PML Antibody

Sign In for Pricing
View Details
Cap2 Mouse Gene Knockout Kit (CRISPR)
KN502500 1 Kit

Cap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details