Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESM-1, Mouse (HEK293, His)

ESM-1 (Endocan) serves a vital role in angiogenesis by promoting new blood vessel sprouting. Its implication in lung endothelial cell-leukocyte interactions suggests potential significance in regulating immune responses within the pulmonary vasculature. ESM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ESM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ESM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/esm-1-protein-mouse-hek-293-his.html

Purity

95.50

Smiles

WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR

Molecular Formula

71690 (Gene_ID) Q9QYY7 (W20-R184) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-D,L-homotryptophan
TRC-A178400-10MG 10 mg

N-Acetyl-D,L-homotryptophan

Sign In for Pricing
View Details
(3R,5S,6E)-7-(2-Cyclopropyl-4-phenyl-3-quinolinyl)-3,5-dihydroxy-6-heptenoic Acid tert-Butyl Ester
TRC-C989560-5MG 5 mg

(3R,5S,6E)-7-(2-Cyclopropyl-4-phenyl-3-quinolinyl)-3,5-dihydroxy-6-heptenoic Acid tert-Butyl Ester

Sign In for Pricing
View Details
CD101 Human Gene Knockout Kit (CRISPR)
KN419415 1 Kit

CD101 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EDA Rabbit Polyclonal Antibody
TA364765 100 µL

EDA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504133 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
IL12 Human, His
OM296490-01 1 mg

IL12 Human, His

Sign In for Pricing
View Details