Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESM-1, Mouse (HEK293, His)

ESM-1 (Endocan) serves a vital role in angiogenesis by promoting new blood vessel sprouting. Its implication in lung endothelial cell-leukocyte interactions suggests potential significance in regulating immune responses within the pulmonary vasculature. ESM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ESM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ESM-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/esm-1-protein-mouse-hek-293-his.html

Purity

95.50

Smiles

WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR

Molecular Formula

71690 (Gene_ID) Q9QYY7 (W20-R184) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Plasmalemma Vesicle Associated Protein (PLVAP) ELISA Kit
abx359029 96 Well

Monkey Plasmalemma Vesicle Associated Protein (PLVAP) ELISA Kit

Sign In for Pricing
View Details
Olr775 AAV Vector (Rat) (CMV)
34669106 1 µg

Olr775 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
HYAL4 Protein Vector (Mouse) (pPM-C-His)
PV190393 500 ng

HYAL4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
GENLISA™ Human Lipase, Hepatic (LIPC) ELISA
KBH21447 1x 96 Well

GENLISA™ Human Lipase, Hepatic (LIPC) ELISA

Sign In for Pricing
View Details
LT-β Polyclonal Antibody
46849-01 50 µL

LT-β Polyclonal Antibody

Sign In for Pricing
View Details
LT-β Polyclonal Antibody
46849-02 100 µL

LT-β Polyclonal Antibody

Sign In for Pricing
View Details