IGFLR1, Human (HEK293, C-His)
IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html
Smiles
SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
Molecular Formula
79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)
Molecular Weight
17.4 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
RUNX2, phosphorylated (Ser465) (Runt-related Transcription Factor 2, Core-binding Factor Subunit alpha-1, CBF-alpha-1, Acute Myeloid Leukemia 3 Protein, Oncogene AML-3, Polyomavirus Enhancer-binding Protein 2 alpha A Subunit, PEBP2-alpha A, PEA2-alpha A, SL3-3 Enhancer Factor 1 alpha A Subunit, SL3/AKV Core-binding Factor alpha A Subunit, Osteoblast-specific Transcription Factor 2, OSF-2, AML3, CBFA1, OSF2, PEBP2A) (Azide free) (HRP) discontinued
Mouse Cervix PrimaCell™4: Normal Endometrial Epithelial Cells Growth Medium
