Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmo5 (NM_010232) Mouse Tagged ORF Clone
MG208538 10 µg

Fmo5 (NM_010232) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Desmoglein 3 (DSG3) (NM_001944) Human Recombinant Protein
TP701422 50 µg

Desmoglein 3 (DSG3) (NM_001944) Human Recombinant Protein

Sign In for Pricing
View Details
KLHL5 Protein Vector (Rat) (pPB-N-His)
PV276495 500 ng

KLHL5 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
FOSB Polyclonal Antibody
OABB00432-100UG 100 µg/Vial

FOSB Polyclonal Antibody

Sign In for Pricing
View Details
Complement Component 1 Human (Recombinant)
22060896-1 5 µg

Complement Component 1 Human (Recombinant)

Sign In for Pricing
View Details
Rabbit Polyclonal FAM171A2 Antibody
NBP1-93482 0.1 mL

Rabbit Polyclonal FAM171A2 Antibody

Sign In for Pricing
View Details