Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)
MBS2083155-01 0.1 mL

APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)
MBS2083155-02 0.2 mL

APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)
MBS2083155-03 0.5 mL

APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)
MBS2083155-04 1 mL

APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)
MBS2083155-05 5 mL

APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)
MBS2083155-06 5x 5 mL

APC-Linked Polyclonal Antibody to Kelch Like ECH Associated Protein 1 (KEAP1)

Sign In for Pricing
View Details