Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snrnp48 (NM_026382) Mouse Tagged ORF Clone
MG217906 10 µg

Snrnp48 (NM_026382) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse IFN-gamma ELISA KIT, RT
MBS8506098-01 48 Well

Mouse IFN-gamma ELISA KIT, RT

Sign In for Pricing
View Details
Mouse IFN-gamma ELISA KIT, RT
MBS8506098-02 96 Well

Mouse IFN-gamma ELISA KIT, RT

Sign In for Pricing
View Details
Mouse IFN-gamma ELISA KIT, RT
MBS8506098-03 5x 96 Well

Mouse IFN-gamma ELISA KIT, RT

Sign In for Pricing
View Details
Trichothecenes (T-2) ELISA test kit
LSY-10035 96 Well/Kit

Trichothecenes (T-2) ELISA test kit

Sign In for Pricing
View Details
Thra Rat shRNA Lentiviral Particle (Locus ID 81812)
TL711257V 500 µL Each

Thra Rat shRNA Lentiviral Particle (Locus ID 81812)

Sign In for Pricing
View Details