Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNeonGreen Monoclonal Antibody, Cy7 Conjugated
bsm-33872M-Cy7 100 µL

MNeonGreen Monoclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
SARS-CoV-2 RBD (Val367Phe) Protein (C-His, Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) )
P508104 100 µg

SARS-CoV-2 RBD (Val367Phe) Protein (C-His, Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) )

Sign In for Pricing
View Details
QPCR Kit RNA Tick-borne - EACH
MOL8376 1 Each

QPCR Kit RNA Tick-borne - EACH

Sign In for Pricing
View Details
Recombinant Human Neuroepithelial cell-transforming gene 1 protein
32-9975-50 50 µg

Recombinant Human Neuroepithelial cell-transforming gene 1 protein

Sign In for Pricing
View Details
Mouse Kallikrein 11 ELISA Kit
MBS017920-01 48 Well

Mouse Kallikrein 11 ELISA Kit

Sign In for Pricing
View Details
Mouse Kallikrein 11 ELISA Kit
MBS017920-02 96 Well

Mouse Kallikrein 11 ELISA Kit

Sign In for Pricing
View Details