Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabies Virus (Glycoprotein) Mouse Monoclonal Antibody [Clone ID: 7E3]
3R7-7E3 1 mg

Rabies Virus (Glycoprotein) Mouse Monoclonal Antibody [Clone ID: 7E3]

Sign In for Pricing
View Details
ZMYND11 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV640435 1.0 µg DNA

ZMYND11 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
2-Hydroxy-5-benzyloxyacetophenone
sc-209195 1 g

2-Hydroxy-5-benzyloxyacetophenone

Sign In for Pricing
View Details
Rabbit Monoclonal HVEM/TNFRSF14 Antibody (2742B) [PE]
FAB3563P 0.1 mL

Rabbit Monoclonal HVEM/TNFRSF14 Antibody (2742B) [PE]

Sign In for Pricing
View Details
Porcine Olfactory receptor 7E24 (OR7E24) ELISA Kit
MBS7228102-01 48 Well

Porcine Olfactory receptor 7E24 (OR7E24) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 7E24 (OR7E24) ELISA Kit
MBS7228102-02 96 Well

Porcine Olfactory receptor 7E24 (OR7E24) ELISA Kit

Sign In for Pricing
View Details