Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

THTPA sgRNA CRISPR Lentivector (Human) (Target 2)
K2371903 1.0 µg DNA

THTPA sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
HAI-2 siRNA (m)
sc-39557 10 µM

HAI-2 siRNA (m)

Sign In for Pricing
View Details
GENLISA Human Semenogelin 2 (SEMG-2) ELISA
KBH15889 1x 96 Well

GENLISA Human Semenogelin 2 (SEMG-2) ELISA

Sign In for Pricing
View Details
KDM5A siRNA (Human)
CRH4013-01 15 nmol

KDM5A siRNA (Human)

Sign In for Pricing
View Details
KDM5A siRNA (Human)
CRH4013-02 30 nmol

KDM5A siRNA (Human)

Sign In for Pricing
View Details
Lentiviral human MAEL shRNA (UAS) - Lentiviral human MAEL shRNA (UAS) plasmid
GTR15318382 1 Vial

Lentiviral human MAEL shRNA (UAS) - Lentiviral human MAEL shRNA (UAS) plasmid

Sign In for Pricing
View Details