Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chloroform, GlenPure™, analytical grade stabilised with amylene
GS0166-1l 1 L

Chloroform, GlenPure™, analytical grade stabilised with amylene

Sign In for Pricing
View Details
Human ZNF585A (NM_001288800) AAV Particle
RC239531A1V 250 µL

Human ZNF585A (NM_001288800) AAV Particle

Sign In for Pricing
View Details
RUNX1T1 (ETO) (6K8) Mouse Monoclonal antibody
E28PE5470 100 µL

RUNX1T1 (ETO) (6K8) Mouse Monoclonal antibody

Sign In for Pricing
View Details
PLV3-CMV-Tmc1-3xFLAG-CopGFP-Puro Plasmid
PVT82323 2 µg

PLV3-CMV-Tmc1-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
2'- O- (2- Aminoethylcarbamoyl) adenosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer, immobilized on agarose gel (Rp-2'-AEC-cAMPS-Agarose)
A 126-06 0.6 mL

2'- O- (2- Aminoethylcarbamoyl) adenosine- 3', 5'- cyclic monophosphorothioate, Rp- isomer, immobilized on agarose gel (Rp-2'-AEC-cAMPS-Agarose)

Sign In for Pricing
View Details
NFKBIL2 (TONSL) (NM_013432) Human Tagged ORF Clone Lentiviral Particle
RC201046L2V 200 µL

NFKBIL2 (TONSL) (NM_013432) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details