Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cabin1 Mouse qPCR Primer Pair (NM_172549)
MP201536 200 Reactions

Cabin1 Mouse qPCR Primer Pair (NM_172549)

Sign In for Pricing
View Details
PHAP1 (ANP32A) Rabbit Polyclonal Antibody
TA306131 100 µg

PHAP1 (ANP32A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Floor Standing Shaking Incubator BSFT-1904
BSFT-1904 1 Unit

Floor Standing Shaking Incubator BSFT-1904

Sign In for Pricing
View Details
Lentiviral human APOH shRNA (UAS) - Lentiviral human APOH shRNA (UAS, iRFP) (25)
GTR15112490 1 Vial

Lentiviral human APOH shRNA (UAS) - Lentiviral human APOH shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Os05g0566400 Antibody
PHY4211S 150 μg

Os05g0566400 Antibody

Sign In for Pricing
View Details
Rat PANX3 shRNA Plasmid
abx989888-01 150 µg

Rat PANX3 shRNA Plasmid

Sign In for Pricing
View Details