Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDM15 Protein Vector (Human) (pPM-C-His)
PV032684 500 ng

PRDM15 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Connexin 43 (Cx43, Gap Junction Alpha 1 Protein, CxA-1) (MaxLight 405) discontinued
C7857-08-ML405 100 µL

Connexin 43 (Cx43, Gap Junction Alpha 1 Protein, CxA-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-SCGB3A2 Antibody
MBS8308030-01 0.03 mL

Anti-SCGB3A2 Antibody

Sign In for Pricing
View Details
Anti-SCGB3A2 Antibody
MBS8308030-02 0.05 mL

Anti-SCGB3A2 Antibody

Sign In for Pricing
View Details
Anti-SCGB3A2 Antibody
MBS8308030-03 0.1 mL

Anti-SCGB3A2 Antibody

Sign In for Pricing
View Details
Anti-SCGB3A2 Antibody
MBS8308030-04 0.2 mL

Anti-SCGB3A2 Antibody

Sign In for Pricing
View Details