Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Golgin 97 Antibody [mFluor Violet 500 SE]
NBP2-81753MFV500 0.1 mL

Rabbit Polyclonal Golgin 97 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Lentiviral mouse Rho shRNA (UAS) - Lentiviral mouse Rho shRNA (UAS) (100)
GTR15214794 1 Vial

Lentiviral mouse Rho shRNA (UAS) - Lentiviral mouse Rho shRNA (UAS) (100)

Sign In for Pricing
View Details
Rabbit Monoclonal Progranulin/PGRN Antibody (007) [DyLight 594]
NBP2-89675DL594 0.1 mL

Rabbit Monoclonal Progranulin/PGRN Antibody (007) [DyLight 594]

Sign In for Pricing
View Details
Mouse Fbxl5 activation kit by CRISPRa
GA215095 1 Kit

Mouse Fbxl5 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Polyclonal DAGLB Antibody
NBP3-04826-100ul 100 µL

Rabbit Polyclonal DAGLB Antibody

Sign In for Pricing
View Details
Human Chlamydia trachomatis IgA (CT-IgA) ELISA Kit
NSL2537Hu 96 Tests

Human Chlamydia trachomatis IgA (CT-IgA) ELISA Kit

Sign In for Pricing
View Details