Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GAS6 Protein, C-Fc (Active)
AHG78903 100 μg

Recombinant Human GAS6 Protein, C-Fc (Active)

Sign In for Pricing
View Details
L3MBTL Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV812479 1.0 µg DNA

L3MBTL Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
rac-6-Benzyloxy-8-(oxiran-2-yl)-4H-benzo[1,4]oxazin-3-one
TRC-B287540-5MG 5 mg

rac-6-Benzyloxy-8-(oxiran-2-yl)-4H-benzo[1,4]oxazin-3-one

Sign In for Pricing
View Details
Human Ferritin Matched Antibody Pair Set [ABP-S-07345]
ABP-S-07345 5 Plates

Human Ferritin Matched Antibody Pair Set [ABP-S-07345]

Sign In for Pricing
View Details
HNRNPD (NM_031370) Human Tagged Lenti ORF Clone
RC201796L2 10 µg

HNRNPD (NM_031370) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gm595 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3012502 1.0 µg DNA

Gm595 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details