Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2,4-Difluorophenoxy)acetic acid
TRC-D451163-100MG 100 mg

(2,4-Difluorophenoxy)acetic acid

Sign In for Pricing
View Details
1-Hydroxy-alpha-Phenylcyclopentaneacetic Acid
TRC-C909630-10MG 10 mg

1-Hydroxy-alpha-Phenylcyclopentaneacetic Acid

Sign In for Pricing
View Details
FXYD4 Human shRNA Plasmid Kit (Locus ID 53828)
TR304439 1 Kit

FXYD4 Human shRNA Plasmid Kit (Locus ID 53828)

Sign In for Pricing
View Details
Anti-KIAA1161
Y158516 100 µL

Anti-KIAA1161

Sign In for Pricing
View Details
Alox12e sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3369702 1.0 µg DNA

Alox12e sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ARSA Mouse mAb
E47M51534 100 µL

ARSA Mouse mAb

Sign In for Pricing
View Details