Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Exendin 4 - FAM labeled
B2019438 1 mg

Exendin 4 - FAM labeled

Sign In for Pricing
View Details
APH1A Polyclonal Antibody, Biotin Conjugated
bs-4259R-Biotin 100 µL

APH1A Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
FAU (Ubiquitin-like Protein FUBI) (FITC) discontinued
F0020-20C-FITC 200 µL

FAU (Ubiquitin-like Protein FUBI) (FITC) discontinued

Sign In for Pricing
View Details
Cyno Monkey IgG Depleted Serum
MBS135889-01 50 mL

Cyno Monkey IgG Depleted Serum

Sign In for Pricing
View Details
Cyno Monkey IgG Depleted Serum
MBS135889-02 5x 50 mL

Cyno Monkey IgG Depleted Serum

Sign In for Pricing
View Details
Spata9 3'UTR GFP Stable Cell Line
TU169546 1.0 mL

Spata9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details