IGFLR1, Human (HEK293, C-His)
IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html
Smiles
SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
Molecular Formula
79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)
Molecular Weight
17.4 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
CBFA2T2 (EHT, MTGR1, Protein CBFA2T2, ETO Homologous on Chromosome 20, MTG8-like Protein, MTG8-related Protein 1, Myeloid Translocation-related Protein 1, p85) (AP) discontinued
SMAD2, 3 (Mothers Against Decapentaplegic Homolog 2, MAD Homolog 2, Mothers Against DPP Homolog 2, JV18-1, Mad-related Protein 2, hMAD-2, SMAD Family Member 2, SMAD 2, MADH2, MADR2/Mothers Against Decapentaplegic Homolog 3, MAD Homolog 3, Mad3, Mothers Against DPP Homolog 3, hMAD-3, JV15-2, SMAD Family Member 3, SMAD 3, MADH3)
