Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA-1004 50mg
A24127-50 50 mg

HA-1004 50mg

Sign In for Pricing
View Details
RECQL5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1806406 1.0 µg DNA

RECQL5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral human ATAD1 shRNA (UAS) - Lentiviral human ATAD1 shRNA (UAS, iRFP) (25)
GTR15135230 1 Vial

Lentiviral human ATAD1 shRNA (UAS) - Lentiviral human ATAD1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
NFIB (NM_001190737) Human Tagged ORF Clone
RC231275 10 µg

NFIB (NM_001190737) Human Tagged ORF Clone

Sign In for Pricing
View Details
ALB Antibody
K02001M05G12C-01 50 ug

ALB Antibody

Sign In for Pricing
View Details
ALB Antibody
K02001M05G12C-02 100 ug

ALB Antibody

Sign In for Pricing
View Details