Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFLR1, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFLR1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igflr1-protein-human-hek293-c-his.html

Smiles

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Molecular Formula

79713 (Gene_ID) Q9H665-1 (S23-P163) (Accession)

Molecular Weight

17.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBF3 Recombinant Protein (Mouse)
RP130688 100 µg

EBF3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
SERTAD4 Protein Vector (Mouse) (pPB-C-His)
PV228294 500 ng

SERTAD4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human Homeobox protein Hox-B8 (HOXB8) ELISA Kit
abx527678 96 Tests

Human Homeobox protein Hox-B8 (HOXB8) ELISA Kit

Sign In for Pricing
View Details
SCGB3A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2100607 1.0 µg DNA

SCGB3A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse ATP1B3 shRNA Plasmid
abx969269-01 150 µg

Mouse ATP1B3 shRNA Plasmid

Sign In for Pricing
View Details
Mouse ATP1B3 shRNA Plasmid
abx969269-02 300 µg

Mouse ATP1B3 shRNA Plasmid

Sign In for Pricing
View Details