Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Serine protease SplB (splB)

Product Specifications

Abbreviation

Recombinant Staphylococcus aureus splB protein

Gene Name

SplB

UniProt

A7X3Q8

Expression Region

37-240aa

Organism

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Target Sequence

ENNVTKIQDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVKNDDNRNAYGVYFTPEIKKFIAENIDK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Serine protease that cleaves specifically after the sequence Trp-Glu-Leu-Gln.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.8 kDa

References & Citations

"Mutated response regulator graR is responsible for phenotypic conversion of Staphylococcus aureus from heterogeneous vancomycin-intermediate resistance to vancomycin-intermediate resistance." Neoh H.-M., Cui L., Yuzawa H., Takeuchi F., Matsuo M., Hiramatsu K. Antimicrob. Agents Chemother. 52:45-53 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSG9 Antibody
orb1270821 400 μl

PSG9 Antibody

Sign In for Pricing
View Details
MMP2 Polyclonal Antibody, HRP Conjugated
bs-4605R-HRP-01 20 µL

MMP2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
MMP2 Polyclonal Antibody, HRP Conjugated
bs-4605R-HRP-02 100 µL

MMP2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
NCR1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-41214R-APC-Cy7 100 µL

NCR1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
FOXO3A (Forkhead box O3, AF6q21, AF6q21 protein, DKFZp781A0677, FKHRL1, FKHRL1P2, Forkhead box protein O3, Forkhead in rhabdomyosarcoma-like 1, FOXO2, MGC12739, MGC31925) (PE)
MBS6477083-01 0.1 mL

FOXO3A (Forkhead box O3, AF6q21, AF6q21 protein, DKFZp781A0677, FKHRL1, FKHRL1P2, Forkhead box protein O3, Forkhead in rhabdomyosarcoma-like 1, FOXO2, MGC12739, MGC31925) (PE)

Sign In for Pricing
View Details
FOXO3A (Forkhead box O3, AF6q21, AF6q21 protein, DKFZp781A0677, FKHRL1, FKHRL1P2, Forkhead box protein O3, Forkhead in rhabdomyosarcoma-like 1, FOXO2, MGC12739, MGC31925) (PE)
MBS6477083-02 5x 0.1 mL

FOXO3A (Forkhead box O3, AF6q21, AF6q21 protein, DKFZp781A0677, FKHRL1, FKHRL1P2, Forkhead box protein O3, Forkhead in rhabdomyosarcoma-like 1, FOXO2, MGC12739, MGC31925) (PE)

Sign In for Pricing
View Details