Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protease 7/OmpT, E.coli (His-SUMO)

Protease 7, or OmpT, displays unique proteolytic capabilities, cleaving diverse substrates like T7 RNA polymerase, ferric enterobactin receptor protein (FEP), and protamine. With specificity for paired basic residues, it selectively targets substrates with such motifs, highlighting its pivotal role in diverse biological processes and protein regulation. Protease 7/OmpT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Protease 7/OmpT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Protease 7/OmpT Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protease-7-ompt-protein-e-coli-his-sumo.html

Smiles

STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF

Molecular Formula

913212 (Gene_ID) P58603 (S21-F317) (Accession)

Molecular Weight

Approximately 49.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Rnf32 shRNA (UAS) - Lentiviral mouse Rnf32 shRNA (UAS, GFP) plasmid
GTR15270850 1 Vial

Lentiviral mouse Rnf32 shRNA (UAS) - Lentiviral mouse Rnf32 shRNA (UAS, GFP) plasmid

Ask
View Details
PTPLA Protein Lysate (Human) with C-Ha Tag
38140031 100 µg

PTPLA Protein Lysate (Human) with C-Ha Tag

Ask
View Details
Canine Vascular Endothelial cell Growth Factor (VEGF) ELISA Kit
EIA06604Ca 1 Kit

Canine Vascular Endothelial cell Growth Factor (VEGF) ELISA Kit

Ask
View Details