Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Aerolysin-like protein (aep1)

Product Specifications

Product Name Alternative

Jacalin-type lectin domain-containing protein 5

Abbreviation

Recombinant Zebrafish aep1 protein

Gene Name

Aep1

UniProt

Q5CZR5

Expression Region

1-315aa

Organism

Danio rerio (Zebrafish) (Brachydanio rerio)

Target Sequence

MTYPTNLEIIGGQGGSSFSFTGENNGASLEKIWVWVGGWQIKAVRAWLSDGRDETFGVPSGSHQEYVFTPGECFTSLSLWGNGAGTRLGAIKFKTNKGGEFFAHMTSWGLKTEYPMDVGSGYCLGIVGRGGSDIDCMGFMFLNAVQSTVLTNVNYPTINQLIPKVATEEIKSVSFENKTSVKQEQKVETSKKVIKTSSWSMTKSFSSTFSVEVSAGIPEIAEVSTGFSISFGVESTHSLEQTDEKNETLTTTVEVPPKKKVDVHITIGRASFDLPYTGTVKITCKNGSVLQYETKGQYKGVAYTDIKVNTVEKDL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Pore-forming protein which might play a role in host defense. Exists as an antiparallel dimer in solution. Can also assemble into an octameric pore-like structure spanning the cell membrane. Oligomerization may be triggered by binding of the jacalin-type lectin domain to high-mannose cell-surface proteoglycans, and also requires a low pH environment. In vitro, shows high binding affinity for S.cerevisiae mannan and human HIV virus glycoprotein gp120.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP8 Conjugated Antibody
MBS9445988-01 0.1 mL (Biotin)

LRP8 Conjugated Antibody

Sign In for Pricing
View Details
LRP8 Conjugated Antibody
MBS9445988-02 0.1 mL (AF350)

LRP8 Conjugated Antibody

Sign In for Pricing
View Details
LRP8 Conjugated Antibody
MBS9445988-03 0.1 mL (AF405)

LRP8 Conjugated Antibody

Sign In for Pricing
View Details
LRP8 Conjugated Antibody
MBS9445988-04 0.1 mL (AF488)

LRP8 Conjugated Antibody

Sign In for Pricing
View Details
LRP8 Conjugated Antibody
MBS9445988-05 0.1 mL (AF555)

LRP8 Conjugated Antibody

Sign In for Pricing
View Details
LRP8 Conjugated Antibody
MBS9445988-06 0.1 mL (AF594)

LRP8 Conjugated Antibody

Sign In for Pricing
View Details