Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR9K2 Human qPCR Primer Pair (NM_001005243)
HP201570 200 Reactions

OR9K2 Human qPCR Primer Pair (NM_001005243)

Sign In for Pricing
View Details
Human GSTM4 Recombinant Protein
PPT-13031 100 µg

Human GSTM4 Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human RPP14 sgRNA gene knockout kit - Lentiviral human RPP14 sgRNA gene knockout kit (100)
GTR15356443 1 Vial

Lentiviral human RPP14 sgRNA gene knockout kit - Lentiviral human RPP14 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Human GLTP knockdown cell line
ABC-KD6135 1 Vial

Human GLTP knockdown cell line

Sign In for Pricing
View Details
Hspb7 Mouse shRNA Plasmid (Locus ID 29818)
TL516117 1 Kit

Hspb7 Mouse shRNA Plasmid (Locus ID 29818)

Sign In for Pricing
View Details
Rat Monoclonal IL-17E/IL-25 Antibody (207702) [DyLight 488]
FAB13991K 0.1 mL

Rat Monoclonal IL-17E/IL-25 Antibody (207702) [DyLight 488]

Sign In for Pricing
View Details