Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF43 hFc Chimera, Human
Z05791-100 100 µg

RNF43 hFc Chimera, Human

Sign In for Pricing
View Details
INVICTUS 22 Cu Ft Drosophila Incubator
59-400LH-TE-UK 1 Incubator/Unit

INVICTUS 22 Cu Ft Drosophila Incubator

Sign In for Pricing
View Details
RAF1, NT (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF) (AP) discontinued
R0495-09G8-AP 200 µL

RAF1, NT (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF) (AP) discontinued

Sign In for Pricing
View Details
Uncharacterized protein C15orf62 mitochondrial (C15orf62) Human ELISA Kit
I0823 96 Tests

Uncharacterized protein C15orf62 mitochondrial (C15orf62) Human ELISA Kit

Sign In for Pricing
View Details
RGD1564937 Rat shRNA Plasmid (Locus ID 500995)
TR708775 1 Kit

RGD1564937 Rat shRNA Plasmid (Locus ID 500995)

Sign In for Pricing
View Details
KANK1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV632823 1.0 µg DNA

KANK1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details