Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100 beta Antibody
V3505-20UG 20 µg

S100 beta Antibody

Sign In for Pricing
View Details
Dio2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4402307 1.0 µg DNA

Dio2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
kynurenine 3 monooxygenase (KMO) Human siRNA Oligo Duplex (Locus ID 8564)
SR305629 1 Kit

kynurenine 3 monooxygenase (KMO) Human siRNA Oligo Duplex (Locus ID 8564)

Sign In for Pricing
View Details
Rabbit anti-CKI alpha Antibody, Affinity Purified
A301-991A-T 2 µg

Rabbit anti-CKI alpha Antibody, Affinity Purified

Sign In for Pricing
View Details
Syn2 Rat shRNA Lentiviral Particle (Locus ID 29179)
TL703279V 500 µL Each

Syn2 Rat shRNA Lentiviral Particle (Locus ID 29179)

Sign In for Pricing
View Details
SCN7A sgRNA CRISPR Lentivector (Human) (Target 1)
K2102902 1.0 µg DNA

SCN7A sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details